![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Galactose/glucose-binding protein [53830] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53831] (9 PDB entries) |
![]() | Domain d2hpha_: 2hph A: [136652] automated match to d1glg__ complexed with bgc, ca |
PDB Entry: 2hph (more details), 1.33 Å
SCOPe Domain Sequences for d2hpha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hpha_ c.93.1.1 (A:) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} adtrigvtiykyddnfmsvvrkaieqdakaapdvqllmndsqndqskqndqidvllakgv kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgiiqg dliakhwaanqgwdlnkdgqiqfvllkgepghpdaearttyvikelndkgikteqlqldt amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpe alalvksgalagtvlndannqakatfdlaknladgkgaadgtnwkidnkvvrvpyvgvdk dnlae
Timeline for d2hpha_: