![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (33 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen alpha chain [88887] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88889] (21 PDB entries) |
![]() | Domain d2hpcg1: 2hpc G:126-192 [136650] automatically matched to 2H43 A:126-195 |
PDB Entry: 2hpc (more details), 2.9 Å
SCOP Domain Sequences for d2hpcg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hpcg1 h.1.8.1 (G:126-192) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]} viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql eqviakd
Timeline for d2hpcg1: