Lineage for d2hpcg1 (2hpc G:126-192)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3039950Protein Fibrinogen alpha chain [88887] (4 species)
  7. 3039959Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 3039995Domain d2hpcg1: 2hpc G:126-192 [136650]
    automatically matched to 2H43 A:126-195
    complexed with ca, nag

Details for d2hpcg1

PDB Entry: 2hpc (more details), 2.9 Å

PDB Description: crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
PDB Compounds: (G:) fibrinogen alpha chain

SCOPe Domain Sequences for d2hpcg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hpcg1 h.1.8.1 (G:126-192) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqviakd

SCOPe Domain Coordinates for d2hpcg1:

Click to download the PDB-style file with coordinates for d2hpcg1.
(The format of our PDB-style files is described here.)

Timeline for d2hpcg1: