Lineage for d2hpca1 (2hpc A:126-192)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644538Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2644539Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2644540Protein Fibrinogen alpha chain [88887] (4 species)
  7. 2644549Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 2644589Domain d2hpca1: 2hpc A:126-192 [136648]
    automatically matched to 2H43 A:126-195
    complexed with ca, nag, ndg

Details for d2hpca1

PDB Entry: 2hpc (more details), 2.9 Å

PDB Description: crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
PDB Compounds: (A:) fibrinogen alpha chain

SCOPe Domain Sequences for d2hpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hpca1 h.1.8.1 (A:126-192) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqviakd

SCOPe Domain Coordinates for d2hpca1:

Click to download the PDB-style file with coordinates for d2hpca1.
(The format of our PDB-style files is described here.)

Timeline for d2hpca1: