Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.1: AAT-like [53384] (17 proteins) |
Protein automated matches [190317] (4 species) not a true protein |
Species Garlic (Allium sativum) [TaxId:4682] [187134] (2 PDB entries) |
Domain d2hoxc_: 2hox C: [136646] automated match to d1lk9b_ complexed with cl, nag, p1t |
PDB Entry: 2hox (more details), 1.4 Å
SCOPe Domain Sequences for d2hoxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hoxc_ c.67.1.1 (C:) automated matches {Garlic (Allium sativum) [TaxId: 4682]} kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd mvkak
Timeline for d2hoxc_: