SCOPe 2.06: Domain d2hoxa_: 2hox A:

Lineage for d2hoxa_ (2hox A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein automated matches [190317] (5 species)
   not a true protein

7. Species Garlic (Allium sativum) [TaxId:4682] [187134] (2 PDB entries)

8. Domain d2hoxa_: 2hox A: [136644]
   automated match to d1lk9b_
   complexed with cl, nag, p1t

Details for d2hoxa_

PDB Entry: 2hox, 1.4 Å

PDB Description: alliinase from allium sativum (garlic)

PDB Compounds: (A:) Alliin lyase 1

SCOPe Domain Sequences for d2hoxa_:

Sequence; same for both SEQRES and ATOM records:

>d2hoxa_ c.67.1.1 (A:) automated matches {Garlic (Allium sativum) [TaxId: 4682]}
kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
mvkak

Timeline for d2hoxa_:

• d2hoxa_ first appeared in SCOP 1.73, called d2hoxa1
  
• d2hoxa_ appears in SCOPe 2.05
  
• d2hoxa_ appears in SCOPe 2.07
  
• d2hoxa_ appears in the current release, SCOPe 2.08