Lineage for d2hora1 (2hor A:1-425)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705338Protein Alliinase [82482] (1 species)
    cysteine sulphoxide lyase
  7. 705339Species Garlic (Allium sativum) [TaxId:4682] [82483] (3 PDB entries)
  8. 705342Domain d2hora1: 2hor A:1-425 [136643]
    automatically matched to d1lk9b_
    complexed with act, cl, fuc, man, nag, no3, so4

Details for d2hora1

PDB Entry: 2hor (more details), 1.6 Å

PDB Description: crystal structure of alliinase from garlic- apo form
PDB Compounds: (A:) Alliin lyase 1

SCOP Domain Sequences for d2hora1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hora1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]}
kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
mvkak

SCOP Domain Coordinates for d2hora1:

Click to download the PDB-style file with coordinates for d2hora1.
(The format of our PDB-style files is described here.)

Timeline for d2hora1: