Lineage for d2hora_ (2hor A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131336Protein automated matches [190317] (5 species)
    not a true protein
  7. 2131354Species Garlic (Allium sativum) [TaxId:4682] [187134] (2 PDB entries)
  8. 2131359Domain d2hora_: 2hor A: [136643]
    automated match to d1lk9b_
    complexed with act, cl, nag, no3, so4

Details for d2hora_

PDB Entry: 2hor (more details), 1.6 Å

PDB Description: crystal structure of alliinase from garlic- apo form
PDB Compounds: (A:) Alliin lyase 1

SCOPe Domain Sequences for d2hora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hora_ c.67.1.1 (A:) automated matches {Garlic (Allium sativum) [TaxId: 4682]}
kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
mvkak

SCOPe Domain Coordinates for d2hora_:

Click to download the PDB-style file with coordinates for d2hora_.
(The format of our PDB-style files is described here.)

Timeline for d2hora_: