Lineage for d2hoea2 (2hoe A:200-368)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995675Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 995700Protein N-acetylglucosamine kinase [142469] (1 species)
    Transcriptional regulator, XylR-related
  7. 995701Species Thermotoga maritima [TaxId:2336] [142470] (1 PDB entry)
    Uniprot Q9X0V1 200-368! Uniprot Q9X0V1 72-199
    TM1224
  8. 995702Domain d2hoea2: 2hoe A:200-368 [136640]
    Other proteins in same PDB: d2hoea1
    complexed with gol, k

Details for d2hoea2

PDB Entry: 2hoe (more details), 2.46 Å

PDB Description: crystal structure of n-acetylglucosamine kinase (tm1224) from thermotoga maritima at 2.46 a resolution
PDB Compounds: (A:) N-acetylglucosamine kinase

SCOPe Domain Sequences for d2hoea2:

Sequence, based on SEQRES records: (download)

>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}
ddsfawiltgkgigagiiidgelyrgengyageigytrvfngneyvfledvcnenvvlkh
vlsmgfsslaeardsgdvrvkeyfddiaryfsigllnlihlfgiskiviggffkelgenf
lkkikievethllykhsvdmsfskvqepviafgaavhalenylervtts

Sequence, based on observed residues (ATOM records): (download)

>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}
ddsfawiltgkgigagiiidgelyrgengyageigytrvfngneyvfledvcnenvvlkh
vlsmgfslaeardsgdvrvkeyfddiaryfsigllnlihlfgiskiviggffkelgenfl
kkikievethllykhsvdmsfskvqepviafgaavhalenylervtts

SCOPe Domain Coordinates for d2hoea2:

Click to download the PDB-style file with coordinates for d2hoea2.
(The format of our PDB-style files is described here.)

Timeline for d2hoea2: