![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.63: ROK associated domain [140279] (3 proteins) found N-terminal to ROK domain in some proteins |
![]() | Protein N-acetylglucosamine kinase [140282] (1 species) Transcriptional regulator, XylR-related |
![]() | Species Thermotoga maritima [TaxId:2336] [140283] (1 PDB entry) Uniprot Q9X0V1 10-71 |
![]() | Domain d2hoea1: 2hoe A:10-71 [136639] Other proteins in same PDB: d2hoea2, d2hoea3 complexed with gol, k |
PDB Entry: 2hoe (more details), 2.46 Å
SCOPe Domain Sequences for d2hoea1:
Sequence, based on SEQRES records: (download)
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} isrilkrimkspvsrvelaeelgltkttvgeiakiflekgivveekdspkgvgrptkslk is
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} isrilkrimkspvsrvelaeelgltkttvgeiakiflekgivveekdsprptkslkis
Timeline for d2hoea1: