Lineage for d2hnxa2 (2hnx A:0-131)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414379Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2414380Species Human (Homo sapiens) [TaxId:9606] [110275] (25 PDB entries)
    Uniprot P15090
  8. 2414392Domain d2hnxa2: 2hnx A:0-131 [136633]
    Other proteins in same PDB: d2hnxa3
    automated match to d1toua_
    complexed with acy, plm, po4

Details for d2hnxa2

PDB Entry: 2hnx (more details), 1.5 Å

PDB Description: Crystal Structure of aP2
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d2hnxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hnxa2 b.60.1.2 (A:0-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm
kgvtstrvyera

SCOPe Domain Coordinates for d2hnxa2:

Click to download the PDB-style file with coordinates for d2hnxa2.
(The format of our PDB-style files is described here.)

Timeline for d2hnxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hnxa3