![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110275] (25 PDB entries) Uniprot P15090 |
![]() | Domain d2hnxa2: 2hnx A:0-131 [136633] Other proteins in same PDB: d2hnxa3 automated match to d1toua_ complexed with acy, plm, po4 |
PDB Entry: 2hnx (more details), 1.5 Å
SCOPe Domain Sequences for d2hnxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnxa2 b.60.1.2 (A:0-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]} mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm kgvtstrvyera
Timeline for d2hnxa2: