Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [110275] (17 PDB entries) Uniprot P15090 |
Domain d2hnxa_: 2hnx A: [136633] automated match to d1toua_ complexed with acy, plm, po4 |
PDB Entry: 2hnx (more details), 1.5 Å
SCOPe Domain Sequences for d2hnxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnxa_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]} rgshmcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitikses tfknteisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvv ecvmkgvtstrvyera
Timeline for d2hnxa_: