SCOP 1.73: Domain d2hnxa1: 2hnx A:1-131

Lineage for d2hnxa1 (2hnx A:1-131)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110275] (4 PDB entries)

8. Domain d2hnxa1: 2hnx A:1-131 [136633]
   automatically matched to d1toua_
   complexed with acy, plm, po4

Details for d2hnxa1

PDB Entry: 2hnx, 1.5 Å

PDB Description: Crystal Structure of aP2

PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOP Domain Sequences for d2hnxa1:

Sequence; same for both SEQRES and ATOM records:

>d2hnxa1 b.60.1.2 (A:1-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfknt
eisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmk
gvtstrvyera

Timeline for d2hnxa1:

• d2hnxa1 is new in SCOP 1.73
  
• d2hnxa1 appears in SCOP 1.75
  
• d2hnxa1 appears in the current release, SCOPe 2.08, called d2hnxa2