![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Human (Homo sapiens), HLA-A11 [TaxId:9606] [110840] (4 PDB entries) Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor |
![]() | Domain d2hn7a2: 2hn7 A:1-181 [136630] Other proteins in same PDB: d2hn7a1, d2hn7b_ automatically matched to d1q94a2 complexed with so4 |
PDB Entry: 2hn7 (more details), 1.6 Å
SCOPe Domain Sequences for d2hn7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hn7a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A11 [TaxId: 9606]} gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dqetrnvkaqsqtdrvdlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydg kdyialnedlrswtaadmaaqitkrkweaahaaeqqraylegrcvewlrrylengketlq r
Timeline for d2hn7a2: