Lineage for d2hn7a1 (2hn7 A:182-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654550Domain d2hn7a1: 2hn7 A:182-274 [136629]
    Other proteins in same PDB: d2hn7a2, d2hn7b1
    automatically matched to d1q94a1
    complexed with so4

Details for d2hn7a1

PDB Entry: 2hn7 (more details), 1.6 Å

PDB Description: HLA-A*1101 in complex with HBV peptide homologue
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-11 alpha chain

SCOP Domain Sequences for d2hn7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hn7a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrw

SCOP Domain Coordinates for d2hn7a1:

Click to download the PDB-style file with coordinates for d2hn7a1.
(The format of our PDB-style files is described here.)

Timeline for d2hn7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hn7a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hn7b1