| Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family) ![]() forms homopentameric channel |
| Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein) C-terminal part of Pfam PF01544 |
| Protein Magnesium transport protein CorA [144085] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries) |
| Domain d2hn2e2: 2hn2 E:5286-5349 [136628] Other proteins in same PDB: d2hn2a1, d2hn2b1, d2hn2c1, d2hn2d1, d2hn2e1 automatically matched to 2BBJ A:286-349 complexed with ca |
PDB Entry: 2hn2 (more details), 3.7 Å
SCOP Domain Sequences for d2hn2e2:
Sequence, based on SEQRES records: (download)
>d2hn2e2 f.17.3.1 (E:5286-5349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf
kkkk
>d2hn2e2 f.17.3.1 (E:5286-5349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfgypvvlavmgviavimvvyfkkkk
Timeline for d2hn2e2: