SCOP 1.73: Domain d2hn2e2: 2hn2 E:5286-5349

Lineage for d2hn2e2 (2hn2 E:5286-5349)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family)
   forms homopentameric channel

5. Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein)
   C-terminal part of Pfam PF01544

6. Protein Magnesium transport protein CorA [144085] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries)

8. Domain d2hn2e2: 2hn2 E:5286-5349 [136628]
   Other proteins in same PDB: d2hn2a1, d2hn2b1, d2hn2c1, d2hn2d1, d2hn2e1
   automatically matched to 2BBJ A:286-349
   complexed with ca

Details for d2hn2e2

PDB Entry: 2hn2, 3.7 Å

PDB Description: crystal structure of the cora mg2+ transporter homologue from t. maritima in complex with divalent cations

PDB Compounds: (E:) Magnesium transport protein corA

SCOP Domain Sequences for d2hn2e2:

Sequence, based on SEQRES records:

>d2hn2e2 f.17.3.1 (E:5286-5349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf
kkkk

Sequence, based on observed residues (ATOM records):

>d2hn2e2 f.17.3.1 (E:5286-5349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfgypvvlavmgviavimvvyfkkkk

Timeline for d2hn2e2:

• d2hn2e2 is new in SCOP 1.73
  
• d2hn2e2 appears in SCOP 1.75
  
• d2hn2e2 appears in the current release, SCOPe 2.08