Lineage for d2hn2d1 (2hn2 D:4009-4285)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741889Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 741890Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 741891Family d.328.1.1: CorA soluble domain-like [143866] (1 protein)
    N-terminal part of Pfam PF01544
  6. 741892Protein Magnesium transport protein CorA, soluble domain [143867] (1 species)
  7. 741893Species Thermotoga maritima [TaxId:2336] [143868] (4 PDB entries)
  8. 741908Domain d2hn2d1: 2hn2 D:4009-4285 [136625]
    Other proteins in same PDB: d2hn2a2, d2hn2b2, d2hn2c2, d2hn2d2, d2hn2e2
    automatically matched to 2BBJ A:9-285
    complexed with ca

Details for d2hn2d1

PDB Entry: 2hn2 (more details), 3.7 Å

PDB Description: crystal structure of the cora mg2+ transporter homologue from t. maritima in complex with divalent cations
PDB Compounds: (D:) Magnesium transport protein corA

SCOP Domain Sequences for d2hn2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hn2d1 d.328.1.1 (D:4009-4285) Magnesium transport protein CorA, soluble domain {Thermotoga maritima [TaxId: 2336]}
kkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgih
rtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseqvs
liltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvlleki
ddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketv
pyfrdvydhtiqiadtvetfrdivsglldvylssvsn

SCOP Domain Coordinates for d2hn2d1:

Click to download the PDB-style file with coordinates for d2hn2d1.
(The format of our PDB-style files is described here.)

Timeline for d2hn2d1: