![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.328: CorA soluble domain-like [143864] (1 superfamily) beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel |
![]() | Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) ![]() |
![]() | Family d.328.1.1: CorA soluble domain-like [143866] (1 protein) N-terminal part of Pfam PF01544 |
![]() | Protein Magnesium transport protein CorA, soluble domain [143867] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [143868] (4 PDB entries) |
![]() | Domain d2hn2c1: 2hn2 C:3009-3285 [136623] Other proteins in same PDB: d2hn2a2, d2hn2b2, d2hn2c2, d2hn2d2, d2hn2e2 automatically matched to 2BBJ A:9-285 complexed with ca |
PDB Entry: 2hn2 (more details), 3.7 Å
SCOP Domain Sequences for d2hn2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hn2c1 d.328.1.1 (C:3009-3285) Magnesium transport protein CorA, soluble domain {Thermotoga maritima [TaxId: 2336]} kkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgih rtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseqvs liltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvlleki ddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketv pyfrdvydhtiqiadtvetfrdivsglldvylssvsn
Timeline for d2hn2c1: