Lineage for d2hn2b1 (2hn2 B:2009-2285)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011079Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 3011080Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 3011081Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins)
    N-terminal part of Pfam PF01544
  6. 3011082Protein Magnesium transport protein CorA, soluble domain [143867] (1 species)
  7. 3011083Species Thermotoga maritima [TaxId:2336] [143868] (3 PDB entries)
    Uniprot Q9WZ31 13-244! Uniprot Q9WZ31 9-285
  8. 3011086Domain d2hn2b1: 2hn2 B:2009-2285 [136621]
    Other proteins in same PDB: d2hn2a2, d2hn2b2, d2hn2c2, d2hn2d2, d2hn2e2
    automatically matched to 2BBJ A:9-285
    complexed with ca

Details for d2hn2b1

PDB Entry: 2hn2 (more details), 3.7 Å

PDB Description: crystal structure of the cora mg2+ transporter homologue from t. maritima in complex with divalent cations
PDB Compounds: (B:) Magnesium transport protein corA

SCOPe Domain Sequences for d2hn2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hn2b1 d.328.1.1 (B:2009-2285) Magnesium transport protein CorA, soluble domain {Thermotoga maritima [TaxId: 2336]}
kkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgih
rtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseqvs
liltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvlleki
ddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketv
pyfrdvydhtiqiadtvetfrdivsglldvylssvsn

SCOPe Domain Coordinates for d2hn2b1:

Click to download the PDB-style file with coordinates for d2hn2b1.
(The format of our PDB-style files is described here.)

Timeline for d2hn2b1: