Lineage for d2hn2a2 (2hn2 A:1286-1349)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024193Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family) (S)
    forms homopentameric channel
  5. 3024194Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein)
    C-terminal part of Pfam PF01544
  6. 3024195Protein Magnesium transport protein CorA [144085] (2 species)
  7. 3024196Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries)
    Uniprot Q9WZ31 286-349
  8. 3024207Domain d2hn2a2: 2hn2 A:1286-1349 [136620]
    Other proteins in same PDB: d2hn2a1, d2hn2b1, d2hn2c1, d2hn2d1, d2hn2e1
    automatically matched to 2BBJ A:286-349
    complexed with ca

Details for d2hn2a2

PDB Entry: 2hn2 (more details), 3.7 Å

PDB Description: crystal structure of the cora mg2+ transporter homologue from t. maritima in complex with divalent cations
PDB Compounds: (A:) Magnesium transport protein corA

SCOPe Domain Sequences for d2hn2a2:

Sequence, based on SEQRES records: (download)

>d2hn2a2 f.17.3.1 (A:1286-1349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf
kkkk

Sequence, based on observed residues (ATOM records): (download)

>d2hn2a2 f.17.3.1 (A:1286-1349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfgypvvlavmgviavimvvyfkkkk

SCOPe Domain Coordinates for d2hn2a2:

Click to download the PDB-style file with coordinates for d2hn2a2.
(The format of our PDB-style files is described here.)

Timeline for d2hn2a2: