SCOPe 2.08: Domain d2hn2a1: 2hn2 A:1009-1285

Lineage for d2hn2a1 (2hn2 A:1009-1285)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
   beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel

4. Superfamily d.328.1: CorA soluble domain-like [143865] (1 family)

5. Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins)
   N-terminal part of Pfam PF01544

6. Protein Magnesium transport protein CorA, soluble domain [143867] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [143868] (3 PDB entries)
   Uniprot Q9WZ31 13-244! Uniprot Q9WZ31 9-285

8. Domain d2hn2a1: 2hn2 A:1009-1285 [136619]
   Other proteins in same PDB: d2hn2a2, d2hn2b2, d2hn2c2, d2hn2d2, d2hn2e2
   automatically matched to 2BBJ A:9-285
   complexed with ca

Details for d2hn2a1

PDB Entry: 2hn2, 3.7 Å

PDB Description: crystal structure of the cora mg2+ transporter homologue from t. maritima in complex with divalent cations

PDB Compounds: (A:) Magnesium transport protein corA

SCOPe Domain Sequences for d2hn2a1:

Sequence; same for both SEQRES and ATOM records:

>d2hn2a1 d.328.1.1 (A:1009-1285) Magnesium transport protein CorA, soluble domain {Thermotoga maritima [TaxId: 2336]}
kkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgih
rtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseqvs
liltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvlleki
ddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketv
pyfrdvydhtiqiadtvetfrdivsglldvylssvsn

Timeline for d2hn2a1:

• d2hn2a1 first appeared in SCOP 1.73
  
• d2hn2a1 appears in SCOPe 2.07