SCOP 1.73: Domain d2hmwb1: 2hmw B:8-140

Lineage for d2hmwb1 (2hmw B:8-140)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)

6. Protein Ktn bsu222 [75118] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)

8. Domain d2hmwb1: 2hmw B:8-140 [136618]
   automatically matched to d1lsua_
   complexed with atp; mutant

Details for d2hmwb1

PDB Entry: 2hmw, 3 Å

PDB Description: square-shaped octameric ring structure of an rck domain with atp bound

PDB Compounds: (B:) YuaA protein

SCOP Domain Sequences for d2hmwb1:

Sequence; same for both SEQRES and ATOM records:

>d2hmwb1 c.2.1.9 (B:8-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
qfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellslg
irnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpekd
mgvkiaqslsden

Timeline for d2hmwb1:

• d2hmwb1 is new in SCOP 1.73
  
• d2hmwb1 appears in SCOP 1.75
  
• d2hmwb1 appears in the current release, SCOPe 2.08, called d2hmwb_