![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins) |
![]() | Protein Ktn bsu222 [75118] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries) |
![]() | Domain d2hmwb1: 2hmw B:8-140 [136618] automatically matched to d1lsua_ complexed with atp; mutant |
PDB Entry: 2hmw (more details), 3 Å
SCOP Domain Sequences for d2hmwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmwb1 c.2.1.9 (B:8-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} qfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellslg irnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpekd mgvkiaqslsden
Timeline for d2hmwb1: