SCOPe 2.06: Domain d2hmwa_: 2hmw A:

Lineage for d2hmwa_ (2hmw A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
   automatically mapped to Pfam PF02254

6. Protein Ktn bsu222 [75118] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)

8. Domain d2hmwa_: 2hmw A: [136617]
   automated match to d2hmva_
   complexed with atp

Details for d2hmwa_

PDB Entry: 2hmw, 3 Å

PDB Description: square-shaped octameric ring structure of an rck domain with atp bound

PDB Compounds: (A:) YuaA protein

SCOPe Domain Sequences for d2hmwa_:

Sequence; same for both SEQRES and ATOM records:

>d2hmwa_ c.2.1.9 (A:) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
nkqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenells
lgirnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpe
kdmgvkiaqslsden

Timeline for d2hmwa_:

• d2hmwa_ first appeared in SCOP 1.73, called d2hmwa1
  
• d2hmwa_ appears in SCOPe 2.05
  
• d2hmwa_ appears in SCOPe 2.07
  
• d2hmwa_ appears in the current release, SCOPe 2.08