Lineage for d2hmvb_ (2hmv B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978165Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)
  6. 978166Protein Ktn bsu222 [75118] (1 species)
  7. 978167Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)
  8. 978169Domain d2hmvb_: 2hmv B: [136616]
    automated match to d1lsua_
    complexed with adp

Details for d2hmvb_

PDB Entry: 2hmv (more details), 2.2 Å

PDB Description: diamond-shaped octameric ring structure of an rck domain with adp bound
PDB Compounds: (B:) YuaA protein

SCOPe Domain Sequences for d2hmvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmvb_ c.2.1.9 (B:) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
dmgvkiaqslsdenv

SCOPe Domain Coordinates for d2hmvb_:

Click to download the PDB-style file with coordinates for d2hmvb_.
(The format of our PDB-style files is described here.)

Timeline for d2hmvb_: