SCOP 1.75: Domain d2hmvb1: 2hmv B:7-140

Lineage for d2hmvb1 (2hmv B:7-140)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)

6. Protein Ktn bsu222 [75118] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)

8. Domain d2hmvb1: 2hmv B:7-140 [136616]
   automatically matched to d1lsua_
   complexed with adp; mutant

Details for d2hmvb1

PDB Entry: 2hmv, 2.2 Å

PDB Description: diamond-shaped octameric ring structure of an rck domain with adp bound

PDB Compounds: (B:) YuaA protein

SCOP Domain Sequences for d2hmvb1:

Sequence; same for both SEQRES and ATOM records:

>d2hmvb1 c.2.1.9 (B:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
dmgvkiaqslsden

Timeline for d2hmvb1:

• d2hmvb1 first appeared in SCOP 1.73
  
• d2hmvb1 is called d2hmvb_ in SCOPe 2.01
  
• d2hmvb1 appears in the current release, SCOPe 2.08, called d2hmvb_