SCOPe 2.07: Domain d2hmub_: 2hmu B:

Lineage for d2hmub_ (2hmu B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
   automatically mapped to Pfam PF02254

6. Protein Ktn bsu222 [75118] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)

8. Domain d2hmub_: 2hmu B: [136614]
   automated match to d1lsua_
   complexed with atp

Details for d2hmub_

PDB Entry: 2hmu, 2.25 Å

PDB Description: diamond-shaped octameric ring structure of an rck domain with atp bound

PDB Compounds: (B:) YuaA protein

SCOPe Domain Sequences for d2hmub_:

Sequence; same for both SEQRES and ATOM records:

>d2hmub_ c.2.1.9 (B:) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
dmgvkiaqslsdenv

Timeline for d2hmub_:

• d2hmub_ first appeared in SCOP 1.73, called d2hmub1
  
• d2hmub_ appears in SCOPe 2.06
  
• d2hmub_ appears in the current release, SCOPe 2.08