Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins) automatically mapped to Pfam PF02254 |
Protein Ktn bsu222 [75118] (1 species) |
Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries) |
Domain d2hmsd_: 2hms D: [136610] automated match to d1lsua_ complexed with nai |
PDB Entry: 2hms (more details), 2.7 Å
SCOPe Domain Sequences for d2hmsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmsd_ c.2.1.9 (D:) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek dmgvkiaqslsden
Timeline for d2hmsd_: