Lineage for d2hmsc_ (2hms C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845624Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2845625Protein Ktn bsu222 [75118] (1 species)
  7. 2845626Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)
  8. 2845635Domain d2hmsc_: 2hms C: [136609]
    automated match to d1lsua_
    complexed with nai

Details for d2hmsc_

PDB Entry: 2hms (more details), 2.7 Å

PDB Description: rectangular-shaped octameric ring structure of an rck domain with nadh bound
PDB Compounds: (C:) YuaA protein

SCOPe Domain Sequences for d2hmsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmsc_ c.2.1.9 (C:) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
dmgvkiaqslsdenvlny

SCOPe Domain Coordinates for d2hmsc_:

Click to download the PDB-style file with coordinates for d2hmsc_.
(The format of our PDB-style files is described here.)

Timeline for d2hmsc_: