Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins) |
Protein Ktn bsu222 [75118] (1 species) |
Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries) |
Domain d2hmsb1: 2hms B:7-140 [136608] automatically matched to d1lsua_ complexed with nai; mutant |
PDB Entry: 2hms (more details), 2.7 Å
SCOP Domain Sequences for d2hmsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmsb1 c.2.1.9 (B:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek dmgvkiaqslsden
Timeline for d2hmsb1: