Lineage for d2hmsa1 (2hms A:7-140)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688610Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)
  6. 688611Protein Ktn bsu222 [75118] (1 species)
  7. 688612Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)
  8. 688621Domain d2hmsa1: 2hms A:7-140 [136607]
    automatically matched to d1lsua_
    complexed with nai; mutant

Details for d2hmsa1

PDB Entry: 2hms (more details), 2.7 Å

PDB Description: rectangular-shaped octameric ring structure of an rck domain with nadh bound
PDB Compounds: (A:) YuaA protein

SCOP Domain Sequences for d2hmsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmsa1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
dmgvkiaqslsden

SCOP Domain Coordinates for d2hmsa1:

Click to download the PDB-style file with coordinates for d2hmsa1.
(The format of our PDB-style files is described here.)

Timeline for d2hmsa1: