![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species) |
![]() | Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries) |
![]() | Domain d2hmob_: 2hmo B: [136602] Other proteins in same PDB: d2hmoa1, d2hmoa2 automated match to d1eg9b_ complexed with 3nt, edo, fe, fes, so4 |
PDB Entry: 2hmo (more details), 1.6 Å
SCOPe Domain Sequences for d2hmob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmob_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]} iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype rilqthnlmvfl
Timeline for d2hmob_: