Lineage for d2hmob_ (2hmo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936620Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 2936634Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries)
  8. 2936637Domain d2hmob_: 2hmo B: [136602]
    Other proteins in same PDB: d2hmoa1, d2hmoa2
    automated match to d1eg9b_
    complexed with 3nt, edo, fe, fes, so4

Details for d2hmob_

PDB Entry: 2hmo (more details), 1.6 Å

PDB Description: Crystal Structure of Naphthalene 1,2-Dioxygenase Bound to 3-Nitrotoluene.
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d2hmob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmob_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

SCOPe Domain Coordinates for d2hmob_:

Click to download the PDB-style file with coordinates for d2hmob_.
(The format of our PDB-style files is described here.)

Timeline for d2hmob_: