SCOPe 2.01: Domain d2hmoa2: 2hmo A:155-446

Lineage for d2hmoa2 (2hmo A:155-446)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species)

7. Species Pseudomonas putida [TaxId:303] [55971] (16 PDB entries)

8. Domain d2hmoa2: 2hmo A:155-446 [136601]
   Other proteins in same PDB: d2hmoa1, d2hmob_
   automatically matched to d1o7ga2
   complexed with 3nt, edo, fe, fes, so4

Details for d2hmoa2

PDB Entry: 2hmo, 1.6 Å

PDB Description: Crystal Structure of Naphthalene 1,2-Dioxygenase Bound to 3-Nitrotoluene.

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d2hmoa2:

Sequence; same for both SEQRES and ATOM records:

>d2hmoa2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt

Timeline for d2hmoa2:

• d2hmoa2 first appeared in SCOP 1.73
  
• d2hmoa2 appears in SCOP 1.75
  
• d2hmoa2 appears in SCOPe 2.02
  
• d2hmoa2 appears in the current release, SCOPe 2.08