SCOPe 2.08: Domain d2hmoa1: 2hmo A:1-154

Lineage for d2hmoa1 (2hmo A:1-154)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)

7. Species Pseudomonas sp. [TaxId:69011] [228594] (13 PDB entries)

8. Domain d2hmoa1: 2hmo A:1-154 [136600]
   Other proteins in same PDB: d2hmoa2, d2hmob_
   automated match to d1o7na1
   complexed with 3nt, edo, fe, fes, so4

Details for d2hmoa1

PDB Entry: 2hmo, 1.6 Å

PDB Description: Crystal Structure of Naphthalene 1,2-Dioxygenase Bound to 3-Nitrotoluene.

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d2hmoa1:

Sequence; same for both SEQRES and ATOM records:

>d2hmoa1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 69011]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

Timeline for d2hmoa1:

• d2hmoa1 first appeared in SCOP 1.73
  
• d2hmoa1 appears in SCOPe 2.07