Lineage for d2hmnb_ (2hmn B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896464Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1896476Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 1896490Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries)
  8. 1896496Domain d2hmnb_: 2hmn B: [136599]
    Other proteins in same PDB: d2hmna1, d2hmna2
    automated match to d1eg9b_
    complexed with an3, edo, fe, fes, so4; mutant

Details for d2hmnb_

PDB Entry: 2hmn (more details), 1.7 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to anthracene.
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d2hmnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmnb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

SCOPe Domain Coordinates for d2hmnb_:

Click to download the PDB-style file with coordinates for d2hmnb_.
(The format of our PDB-style files is described here.)

Timeline for d2hmnb_: