Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species) |
Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries) |
Domain d2hmnb_: 2hmn B: [136599] Other proteins in same PDB: d2hmna1, d2hmna2 automated match to d1eg9b_ complexed with an3, edo, fe, fes, so4; mutant |
PDB Entry: 2hmn (more details), 1.7 Å
SCOPe Domain Sequences for d2hmnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmnb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]} iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype rilqthnlmvfl
Timeline for d2hmnb_: