Lineage for d2hmna2 (2hmn A:155-446)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733462Superfamily d.129.3: Bet v1-like [55961] (7 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 733518Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 733533Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species)
  7. 733534Species Pseudomonas putida [TaxId:303] [55971] (16 PDB entries)
  8. 733542Domain d2hmna2: 2hmn A:155-446 [136598]
    Other proteins in same PDB: d2hmna1, d2hmnb1
    automatically matched to d1o7ga2
    complexed with an3, edo, fe, fes, so4; mutant

Details for d2hmna2

PDB Entry: 2hmn (more details), 1.7 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to anthracene.
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOP Domain Sequences for d2hmna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmna2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtvgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt

SCOP Domain Coordinates for d2hmna2:

Click to download the PDB-style file with coordinates for d2hmna2.
(The format of our PDB-style files is described here.)

Timeline for d2hmna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hmna1
View in 3D
Domains from other chains:
(mouse over for more information)
d2hmnb1