SCOPe 2.06: Domain d2hmna1: 2hmn A:1-154

Lineage for d2hmna1 (2hmn A:1-154)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)

7. Species Pseudomonas sp. [TaxId:306] [255216] (3 PDB entries)

8. Domain d2hmna1: 2hmn A:1-154 [136597]
   Other proteins in same PDB: d2hmna2, d2hmnb_
   automated match to d1o7na1
   complexed with an3, edo, fe, fes, so4; mutant

Details for d2hmna1

PDB Entry: 2hmn, 1.7 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to anthracene.

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d2hmna1:

Sequence; same for both SEQRES and ATOM records:

>d2hmna1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 306]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

Timeline for d2hmna1:

• d2hmna1 first appeared in SCOP 1.73
  
• d2hmna1 appears in SCOPe 2.05
  
• d2hmna1 appears in SCOPe 2.07
  
• d2hmna1 appears in the current release, SCOPe 2.08