Lineage for d2hmla2 (2hml A:155-446)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669085Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1669177Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1669209Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)
  7. Species Pseudomonas sp. [TaxId:306] [255217] (3 PDB entries)
  8. 1669226Domain d2hmla2: 2hml A:155-446 [136592]
    Other proteins in same PDB: d2hmla1, d2hmlb_
    automated match to d1eg9a2
    complexed with edo, fe, fes, pey, so4; mutant

Details for d2hmla2

PDB Entry: 2hml (more details), 1.8 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to phenanthrene.
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d2hmla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmla2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas sp. [TaxId: 306]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtvgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt

SCOPe Domain Coordinates for d2hmla2:

Click to download the PDB-style file with coordinates for d2hmla2.
(The format of our PDB-style files is described here.)

Timeline for d2hmla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hmla1
View in 3D
Domains from other chains:
(mouse over for more information)
d2hmlb_