Lineage for d2hmkb_ (2hmk B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries)
  8. Domain d2hmkb_: 2hmk B: [136590]
    Other proteins in same PDB: d2hmka1, d2hmka2
    automated match to d1eg9b_
    complexed with edo, fe, fes, pey, so4

Details for d2hmkb_

PDB Entry: 2hmk (more details), 1.6500000000000001 Å

PDB Description: crystal structure of naphthalene 1,2-dioxygenase bound to phenanthrene
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d2hmkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmkb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

SCOPe Domain Coordinates for d2hmkb_ are not available.

Timeline for d2hmkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hmka1, d2hmka2