Class b: All beta proteins [48724] (176 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species) |
Species Pseudomonas sp. [TaxId:69011] [228594] (13 PDB entries) |
Domain d2hmka1: 2hmk A:1-154 [136588] Other proteins in same PDB: d2hmka2, d2hmkb_ automated match to d1o7na1 complexed with edo, fe, fes, pey, so4 |
PDB Entry: 2hmk (more details), 1.65 Å
SCOPe Domain Sequences for d2hmka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmka1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 69011]} mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe kdlygeslnkkclglkevarvesfhgfiygcfdq
Timeline for d2hmka1: