Lineage for d2hmka1 (2hmk A:1-154)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664899Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 664900Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 664968Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 664983Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species)
  7. 664984Species Pseudomonas putida [TaxId:303] [50035] (16 PDB entries)
  8. 664989Domain d2hmka1: 2hmk A:1-154 [136588]
    Other proteins in same PDB: d2hmka2, d2hmkb1
    automatically matched to d1eg9a1
    complexed with edo, fe, fes, pey, so4; mutant

Details for d2hmka1

PDB Entry: 2hmk (more details), 1.65 Å

PDB Description: crystal structure of naphthalene 1,2-dioxygenase bound to phenanthrene
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOP Domain Sequences for d2hmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmka1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida [TaxId: 303]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOP Domain Coordinates for d2hmka1:

Click to download the PDB-style file with coordinates for d2hmka1.
(The format of our PDB-style files is described here.)

Timeline for d2hmka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hmka2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hmkb1