Lineage for d2hmka1 (2hmk A:1-154)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)
  7. Species Pseudomonas sp. [TaxId:69011] [228594] (13 PDB entries)
  8. Domain d2hmka1: 2hmk A:1-154 [136588]
    Other proteins in same PDB: d2hmka2, d2hmkb_
    automated match to d1o7na1
    complexed with edo, fe, fes, pey, so4

Details for d2hmka1

PDB Entry: 2hmk (more details), 1.6500000000000001 Å

PDB Description: crystal structure of naphthalene 1,2-dioxygenase bound to phenanthrene
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d2hmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmka1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 69011]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOPe Domain Coordinates for d2hmka1 are not available.

Timeline for d2hmka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hmka2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hmkb_