Lineage for d2hmjb_ (2hmj B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641078Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1641090Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 1641104Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries)
  8. 1641106Domain d2hmjb_: 2hmj B: [136587]
    Other proteins in same PDB: d2hmja1, d2hmja2
    automated match to d1eg9b_
    complexed with edo, fe, fes, so4; mutant

Details for d2hmjb_

PDB Entry: 2hmj (more details), 1.5 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase phe-352-val mutant.
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d2hmjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmjb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

SCOPe Domain Coordinates for d2hmjb_:

Click to download the PDB-style file with coordinates for d2hmjb_.
(The format of our PDB-style files is described here.)

Timeline for d2hmjb_: