Class b: All beta proteins [48724] (177 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species) |
Domain d2hmja1: 2hmj A:1-154 [136585] Other proteins in same PDB: d2hmja2, d2hmjb_ automated match to d1o7na1 complexed with edo, fe, fes, so4; mutant |
PDB Entry: 2hmj (more details), 1.5 Å
SCOPe Domain Sequences for d2hmja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmja1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 306]} mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe kdlygeslnkkclglkevarvesfhgfiygcfdq
Timeline for d2hmja1: