Lineage for d2hmja1 (2hmj A:1-154)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535669Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1535670Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1535773Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1535805Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)
  7. Species Pseudomonas sp. [TaxId:306] [255216] (3 PDB entries)
  8. 1535820Domain d2hmja1: 2hmj A:1-154 [136585]
    Other proteins in same PDB: d2hmja2, d2hmjb_
    automated match to d1o7na1
    complexed with edo, fe, fes, so4; mutant

Details for d2hmja1

PDB Entry: 2hmj (more details), 1.5 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase phe-352-val mutant.
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d2hmja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmja1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 306]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOPe Domain Coordinates for d2hmja1:

Click to download the PDB-style file with coordinates for d2hmja1.
(The format of our PDB-style files is described here.)

Timeline for d2hmja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hmja2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hmjb_