Lineage for d2hmfd3 (2hmf D:304-403)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197025Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2197174Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. 2197175Protein Aspartokinase [143391] (3 species)
  7. 2197183Species Methanococcus jannaschii [TaxId:2190] [143392] (1 PDB entry)
    Uniprot Q57991 304-403! Uniprot Q57991 404-470
  8. 2197191Domain d2hmfd3: 2hmf D:304-403 [136584]
    Other proteins in same PDB: d2hmfa1, d2hmfb1, d2hmfc1, d2hmfd1
    automated match to d2hmfa3
    complexed with adp, asp, mg

Details for d2hmfd3

PDB Entry: 2hmf (more details), 2.7 Å

PDB Description: structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
PDB Compounds: (D:) Probable aspartokinase

SCOPe Domain Sequences for d2hmfd3:

Sequence, based on SEQRES records: (download)

>d2hmfd3 d.58.18.10 (D:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}
msdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnisl
vvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkd

Sequence, based on observed residues (ATOM records): (download)

>d2hmfd3 d.58.18.10 (D:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}
msdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnisl
vvseedvdkalkalkrefgdflnnnlirdvsvdkd

SCOPe Domain Coordinates for d2hmfd3:

Click to download the PDB-style file with coordinates for d2hmfd3.
(The format of our PDB-style files is described here.)

Timeline for d2hmfd3: