SCOPe 2.06: Domain d2hm9a_: 2hm9 A:

Lineage for d2hm9a_ (2hm9 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Lactobacillus casei [TaxId:1582] [53601] (10 PDB entries)

8. Domain d2hm9a_: 2hm9 A: [136572]
   automated match to d1disa_
   complexed with trr

Details for d2hm9a_

PDB Entry: 2hm9

PDB Description: Solution structure of dihydrofolate reductase complexed with trimethoprim, 33 structures

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2hm9a_:

Sequence; same for both SEQRES and ATOM records:

>d2hm9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

Timeline for d2hm9a_:

• d2hm9a_ first appeared in SCOP 1.73, called d2hm9a1
  
• d2hm9a_ appears in SCOPe 2.05
  
• d2hm9a_ appears in SCOPe 2.07
  
• d2hm9a_ appears in the current release, SCOPe 2.08