![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species) |
![]() | Species Lactobacillus casei [TaxId:1582] [53601] (10 PDB entries) |
![]() | Domain d2hm9a_: 2hm9 A: [136572] automated match to d1disa_ complexed with trr |
PDB Entry: 2hm9 (more details)
SCOPe Domain Sequences for d2hm9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hm9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]} taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka
Timeline for d2hm9a_: