Lineage for d2hlja1 (2hlj A:1-156)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167645Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2167646Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2167647Family d.38.1.1: 4HBT-like [54638] (19 protein domains)
    Pfam PF03061
  6. 2167689Protein Hypothetical protein PP0301 [143144] (1 species)
  7. 2167690Species Pseudomonas putida [TaxId:303] [143145] (1 PDB entry)
    Uniprot Q88R33 1-156
  8. 2167691Domain d2hlja1: 2hlj A:1-156 [136570]
    Other proteins in same PDB: d2hlja2
    complexed with gol

Details for d2hlja1

PDB Entry: 2hlj (more details), 2 Å

PDB Description: crystal structure of a putative thioesterase (kt2440) from pseudomonas putida kt2440 at 2.00 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hlja1:

Sequence, based on SEQRES records: (download)

>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]}
mpalityrttvqedwvdynghlrdafyllifsyatdalmdrigldadsrgqsgnslftle
ahinylhevklgtevwvqtqilgfdrkrlhvyhslhragfdevlaaseqmllhvdlagpq
sapfghttvcrlnhlveqqegaqapqymgrtiklpa

Sequence, based on observed residues (ATOM records): (download)

>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]}
mpalityrttvqedwvdynghlrdafyllifsyatdalmdrigldadsrgqsgnslftle
ahinylhevklgtevwvqtqilgfdrkrlhvyhslhragfdevlaaseqmllhvdlqsap
fghttvcrlnhlveqqegaqapqymgrtiklpa

SCOPe Domain Coordinates for d2hlja1:

Click to download the PDB-style file with coordinates for d2hlja1.
(The format of our PDB-style files is described here.)

Timeline for d2hlja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hlja2